metabolite comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2026-08-01. Numbers and descriptions here follow the published literature rather than marketing material.
Cardarine is a common name for GW501516, also GW-1516, a synthetic compound developed as a peroxisome proliferator-activated receptor delta (PPARδ) agonist. It belongs to a class of agents that modulate gene transcription related to lipid and energy metabolism. The compound was studied in preclinical and early clinical research for metabolic and cardiovascular conditions, but it did not progress to approved therapeutic use. Its name appears in fitness and sports contexts despite not being approved as a drug.
PPARδ is a nuclear receptor that influences transcription of genes involved in fatty acid oxidation, lipid transport, and energy homeostasis. GW501516 binds and activates this receptor with high selectivity relative to PPARα and PPARγ in laboratory assays. Activation alters expression of target genes in skeletal muscle, liver, and adipose tissue in animal models. The exact clinical consequences of these changes in humans remain incompletely characterized, and observed effects in animals do not establish therapeutic benefit or safety.
Published studies have examined GW501516 in animal models of obesity, insulin resistance, and exercise endurance. Early human trials reportedly ended, and development was discontinued after preclinical findings raised concerns about cancer in some rodent studies. Regulatory agencies have not approved cardarine for any medical use. Its availability through non-pharmaceutical channels raises questions about identity, purity, and legal status that are separate from its laboratory pharmacology. Those questions are often addressed through analytical testing rather than assumptions about product labels.
GW501516 acts as an agonist at peroxisome proliferator-activated receptor delta, a nuclear receptor involved in transcription of genes related to lipid handling and energy use. Activation of PPARδ can shift skeletal muscle toward greater fatty acid oxidation in animal models, which is one reason it drew interest for metabolic disease and exercise research. The exact downstream effects depend on tissue, species, dose, and duration. Human data are sparse, so many proposed benefits remain hypotheses rather than established clinical outcomes.
Laboratory studies have examined GW501516 in cell cultures and rodents for conditions such as dyslipidemia, insulin resistance, and obesity. Some trials in humans were initiated, but development was discontinued after preclinical findings raised concerns about cancer in certain models. Those findings do not prove that the compound causes cancer in people, but they contributed to regulatory caution. Later reviews often describe the evidence as preliminary and insufficient for assessing long-term safety.
| Property | Value | Notes |
|---|---|---|
| Chemical class | PPARδ agonist | Not an anabolic steroid. |
| Common synonyms | GW501516, GW-1516 | Cardarine is an informal name. |
| Appearance | White to off-white powder | Typical for research-grade solid. |
| Solubility class | Poorly soluble in water; soluble in some organic solvents | Such as DMSO or ethanol in laboratory settings. |
| Typical storage temperature | Cool, dry, protected from light | Specific conditions vary by supplier and form. |
Cardarine is a common name for GW501516, a synthetic compound first described in the 1990s as a selective agonist of the peroxisome proliferator-activated receptor delta. It was studied in preclinical models for metabolic and cardiovascular conditions, but it has not been approved as a medicine in the United States, Europe, or other major jurisdictions. Retail products labeled as cardarine are generally research chemicals or supplements, not pharmaceutical formulations. Because human safety and efficacy data remain limited, regulatory agencies treat it as an unapproved substance rather than a therapeutic product.
Sporting authorities added GW501516 to prohibited lists after it appeared in athlete samples and online markets. The World Anti-Doping Agency classifies it as a hormone and metabolic modulator, and its use can lead to an anti-doping rule violation. Some early laboratory work suggested effects on fatty acid oxidation and endurance-related metabolism in animals, but those findings do not establish safe or effective use in people. Reports of adverse events in humans are scarce and often anecdotal, which complicates risk assessment.
Safety concerns emerged from long-term animal studies. In rodents given the compound for extended periods, researchers found an increased incidence of certain cancers, including liver and bladder tumors. These findings contributed to the discontinuation of clinical development. Whether similar risks apply to short-term or low-level exposure in humans is not established, and controlled human safety data are limited. The relevance of high-dose rodent carcinogenicity findings to human use remains a subject of debate.
Human trials of GW501516 were small and short in duration. They examined lipid levels, glucose handling, and other metabolic markers, but the programs were halted after the animal cancer findings. No approved therapeutic product exists, and published human data are insufficient for establishing long-term safety. Reports of use for athletic performance come mainly from non-clinical settings and cannot be verified through controlled trials. Independent testing of products sold as cardarine has found inconsistent purity and labeling.
Cardarine has no approved therapeutic indication and is not marketed as a medicine. The World Anti-Doping Agency lists GW501516 as a prohibited substance at all times, covering both in-competition and out-of-competition periods. National laws vary: some countries treat it as an unapproved drug subject to import controls, while others have specific restrictions on sale for human consumption. It is often sold as a research chemical, a label that does not imply safety or legality. Enforcement actions have targeted online vendors and shipments.
Anti-doping laboratories identify GW501516 and related metabolites using liquid chromatography coupled with tandem mass spectrometry. Urine is the most common matrix, though blood and dried blood spots may also be analyzed. The method targets the parent compound and phase I and phase II metabolites, which extend the detection window. Because the substance is prohibited at all times, athletes can be tested outside competition. Detection limits and windows depend on the assay, sample type, and individual metabolism.
Cardarine is frequently described as a fat-burning or endurance-enhancing supplement, but these claims exceed the available evidence. The compound is not a hormone, steroid, or selective androgen receptor modulator. Research articles discuss it as a tool compound for studying PPARδ biology, while anti-doping literature focuses on its abuse and detection. Quality of unapproved products is uncertain, and independent analyses have found impurities or incorrect labeling. Open questions include whether human cancer risk resembles that seen in rodents and how often non-athletes use the substance.
In October 2006, the X Prize Foundation established an initiative to promote the development of full genome sequencing technologies, called the Archon X Prize, intending to award $10 million to "the first Team that can build a device and use it to sequence 100 human genomes within 10 days or less, with an accuracy of no more than one error in every 100,000 bases sequenced, with sequences accurately covering at least 98% of the genome, and at a recurring cost of no more than $10,000 (US) per genome." Each year the National Human Genome Research Institute, or NHGRI, promotes grants for new research and developments in genomics. 2010 grants and 2011 candidates include continuing work in microfluidic, polony and base-heavy sequencing methodologies.
=== Extraterrestrial amino acids === Amino acids in carbonaceous chondrites have important implications for theories describing the delivery of organic compounds to the early Earth and the subsequent development of life. Shortly after its fall and recovery in Australia in 1969, the Murchison meteorite was found to host five protein amino acids (glycine, alanine, valine, proline, and glutamic acid) in addition to 12 non-proteinogenic amino acids including α-aminoisobutyric acid and isovaline, which are rare on Earth. Since then, the number of characterised amino acids in the Murchison meteorite has risen to 96, including 12 of the 20 common biological amino acids, along with hundreds more that have been detected, but remain uncharacterised. While the abundance of amino acids present in terrestrial soils presents a potential source of contamination, most of the amino acids characterised in Murchison are terrestrially rare or absent. Amino acids may be structurally chiral, meaning that they have two possible non-superimposable mirror image structures, termed enantiomers. Conventionally, these are referred to as left-handed (L) and right-handed (D) by analogy with glyceraldehyde. Living beings use L-amino acids, although there is no apparent reason why one enantiomer is favoured over the other as they behave equivalently in biological systems.
The project was suggested to and given the green light by Mazda's Senior Managing Director Keiji Asano while he was on a trip to Indonesia in 1986. Sold alongside the seventh generation 323, an MR90 cost less than half the price of the newer model, but still more expensive than Toyota Kijang and Suzuki Carry "minibuses" as the country imposed 30% tax for saloons. In the past hatchback and wagon were classified as sedan Indonesia, but then revised as "minibus" in early 2000s. This changes boosting the sales of hatchbacks and started the downfall of sedans popularity in Indonesia.
Sources: en.wikipedia.org
==== Second order kinetics ==== In second order reactions, the rate of reaction is proportional to the square of the concentration. By integrating this rate, it can be shown that the concentration [A] of the reactant decreases following this formula:
) and a non-negligible portion of high level waste products and transuranic elements, which strongly contribute to the long-term radiotoxicity of the spent nuclear fuel. The recovery and recycling of uranium and plutonium were the first steps in developing a closed fuel cycle. Furthermore, a strong reduction of the volume, radiotoxicity and heat load of the spent nuclear fuel can be efficiently achieved. Despite the benefits of this first reprocessing approach, an amount of waste must be treated, stored and disposed of in a deep geological repository over a long period of time. Waste from reprocessing and spent nuclear fuel are classified as High Level Waste (HLW) according to the IAEA guidance due to the high emission of radioactivity and decay heat. The first reprocessing approach is based on the PUREX (Plutonium Uranium Reduction EXtraction) process, which is the standard and mature technology applied worldwide to recover uranium and plutonium from spent nuclear fuel at industrial scale. Following the dissolution of the spent fuel in nitric acid and the removal of uranium and plutonium, the generated secondary waste still contains fission and activation products along with transuranic elements that must be isolated from biosphere. Uranium and plutonium are recovered by the well-known tributylphosphate (TBP) ligand in a liquid-liquid extraction process.
=== Provincial–municipal relations === In September 2018, Ford announced that he would use the Canadian Charter of Rights and Freedoms' "notwithstanding" clause to override the ruling of a Superior Court judge which said that Ford's legislation, decreasing the size of Toronto City Council just before the municipal election, was unconstitutional. As Ontario's AG, Mulroney voted in support of the Ford government's use of Section 33 of the Canadian Charter of Rights and Freedoms. According to the Globe and Mail, "constitutional experts and politicians of all parties" criticized her decision as a violation of the sanctity of the judicial process as Attorney General. In October 2020, the Ford government passed the Supporting Ontario’s Recovery Act, 2020, which included a section that banned municipalities in the province from using ranked ballots for their mayoral and city council elections. The move came as multiple cities in the province were planning to switch from first-past-the-post to ranked ballots for the 2022 local elections. In 2022, the government passed the Strong Mayors, Building Homes Act, which granted extra powers to the mayor of Toronto and the mayors of other designated municipalities within their mayor–council governments. The Ford government's Better Regional Governance Act, 2026 gives the province power to appoint chairs/wardens in many regional governments, including in Peel Region, the Regional Municipality of Durham, the Waterloo Regional Municipality, and the Regional Municipality of York.
Sources: en.wikipedia.org
The survival of paregoric through the centuries, and particularly through recent critical decades, is probably due to keen clinical observation and stubborn adherence to the clinical deduction that paregoric is useful in certain types of cough.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
=== Mechanism of Action === AMPA receptors are integral to fast excitatory neurotransmission in the CNS. Each receptor is a tetramer composed of four subunits, each providing a binding site for agonists like glutamate. The ligand-binding domain is formed by the N-terminal tail and the extracellular loop between transmembrane domains three and four. The subunit composition significantly influences the receptor's functional properties, including ion permeability and gating kinetics.
Ethnic tensions created during colonial occupation also resulted in discriminatory policies being adopted in newly independent African nations, such as Uganda under Idi Amin which banned Asians from Uganda, thus creating a mass exodus of the (largely Gujarati) Asian community of Uganda. Such ethnically driven border control policies took forms ranging from anti-Asian sentiment in East Africa to Apartheid policies in South Africa and Namibia (then known as Southwest Africa under South African rule) which created bantustans and pass laws to segregate and impose border controls against non-whites, and encouraged immigration of whites at the expense of Blacks as well as Indians and other Asians. Whilst border control in Europe and east of the Pacific have tightened over time, they have largely been liberalized in Africa, from Yoweri Museveni's reversal of Idi Amin's anti-Asian border controls to the fall of Apartheid (and thus racialized border controls) in South Africa. With the development of border control policies over the course of the 20th century came the standardization of refugee travel documents under the Convention Relating to the Status of Refugees of 1951 and the 1954 Convention travel document for stateless people under the similar 1954 statelessness convention.
Sources: en.wikipedia.org
Cardarine is commonly known as GW501516 or GW-1516. These names refer to the same synthetic compound. It is not a brand-name approved medicine.
No, cardarine is not a steroid. It is classified as a PPARδ agonist. Its structure and receptor target differ from anabolic steroids.
No regulatory agency has approved cardarine as a medicine. It was investigated in early research but development was discontinued. It is not available as a prescription drug.
It binds and activates PPARδ, a nuclear receptor that influences gene expression related to fatty acid metabolism and energy balance. This mechanism has been studied mainly in animals and cell models, not established as a safe human therapy.